Sale

LL-37

Price range: $64.00 through $97.00

Contents: Lyophilized Powder in 3ml vial

Requires reconstitution with bacteriostatic water

Rigorous Third-Party Testing

Every batch of our research chemicals and peptides undergoes third-party testing.

BUY NOW

Description

LL-37 (5mg / 10mg)

Lyophilized Powder | Third-Party Tested | USA-Manufactured

In Stock | Free Shipping on Orders Over $150


Product Specifications

  • Peptide Name: LL-37
  • Molecular Formula: C205H340N60O53
  • Molecular Weight: 4493.30 g/mol
  • CAS Number: 597562-32-8
  • Sequence: [LL-37, 37 aa]
  • Purity: ≥99% (HPLC verified)
  • Form: Lyophilized powder
  • Storage: -20°C (long-term) | 2–8°C (short-term) | Protect from light
  • Shelf Life: Up to 12 months when stored sealed and dry

Compound Overview

LL-37 is a 37–amino acid cationic peptide derived from the human cathelicidin antimicrobial peptide precursor (hCAP18). It is characterized by an amphipathic alpha-helical structure and a defined linear amino acid sequence contributing to its physicochemical properties and analytical detection profile in laboratory research workflows.

In research settings, LL-37 is evaluated for peptide–membrane interaction modeling, structural stability profiling, and analytical quantification using chromatographic and mass spectrometry methodologies. Experimental literature describes its classification within cathelicidin peptide research systems investigated under controlled in vitro and preclinical model conditions. All data referenced on this page is derived from published preclinical animal and in vitro studies. No human clinical trials have established approved uses for LL-37 as a research compound.


Published Preclinical Research

Published literature describes LL-37 as a defined cathelicidin peptide investigated within controlled experimental systems.

  • Structural and conformational characterization in membrane-mimetic environments
  • Peptide–membrane interaction profiling in vitro
  • Analytical identification using LC-MS and chromatographic workflows
  • Comparative evaluation of antimicrobial peptide sequences in preclinical systems

All data referenced on this page is derived from published preclinical animal and in vitro studies. No human clinical trials have established approved uses for LL-37.


Research Applications

  • Peptide identity confirmation using LC-MS methodologies
  • Membrane interaction modeling in laboratory systems
  • Chromatographic method development for long-chain peptides
  • Comparative structural analysis of antimicrobial peptides
  • Preclinical peptide stability and degradation profiling

Physical Specifications

  • Vial Size: 3 mL sterile vial
  • Fill: 5mg or 10mg
  • Appearance: White to off-white lyophilized powder
  • Reconstitution Volume: Researcher-determined under validated laboratory protocols
  • Post-Reconstitution Storage: 2–8°C, use within 30 days
  • Solubility: Water-based laboratory solvents

Compare to Related Compounds

KPV

  • LL-37 is a 37–amino acid cathelicidin peptide, whereas KPV is a short tripeptide fragment composed of three amino acids.
  • These compounds differ significantly in sequence length, molecular weight class, and structural conformation under laboratory characterization workflows.

BPC-157

  • LL-37 is classified as a cathelicidin-derived antimicrobial peptide, whereas BPC-157 is a 15–amino acid pentadecapeptide fragment with a distinct structural framework.
  • Analytical differentiation is based on primary sequence composition, length, and chromatographic behavior in validated peptide research systems.

Handling & Storage

Lyophilized Stability:
When stored sealed in a dry environment protected from light, lyophilized peptide material may maintain chemical stability for up to 12 months at controlled room temperature. For maximum long-term preservation, storage at -20°C is recommended.

Post-Reconstitution Stability:
Following reconstitution under sterile laboratory conditions, the solution may maintain stability for up to 30 days when stored at 2–8°C. Minimize repeated freeze–thaw cycles and protect from light to preserve peptide integrity.

Handling:
Allow vial to equilibrate to room temperature before opening to prevent moisture condensation. Use sterile technique throughout preparation.


Certificate of Analysis & Third-Party Testing

Every batch of BioEdge LL-37 undergoes independent third-party testing prior to release. Testing is performed by ISO-accredited laboratories with results available on each product page.

Identity Confirmation Mass Spectrometry (MS)
Purity Assessment High-Performance Liquid Chromatography (HPLC)
Minimum Purity Acceptance ≥99%
Heavy Metals ICP-MS panel
Sterility USP <71> Sterility Testing
COA Format Batch-specific test results, downloadable on product page

To view testing results, scroll to the 3rd Party Testing section located below the product image.


Why Researchers Choose BioEdge for LL-37

Batch-specific COA from an independent lab. Not a generic PDF recycled across products. Every vial of LL-37 is backed by independent third-party laboratory testing, with a Certificate of Analysis available for review on our product page. HPLC confirms purity. Mass spectrometry confirms molecular identity. The COA corresponds to the specific batch you receive.

USA lyophilization. Many vendors import pre-filled vials from overseas and relabel them. BioEdge sources API and performs lyophilization within the United States, maintaining direct quality control over the final product.

No filler compounds. BioEdge LL-37 is pure lyophilized peptide. No mannitol, no bulking agents, no unnecessary excipients.

Same-day shipping. Domestic orders placed before 3pm ship the same day. Free shipping on orders over $150.


Frequently Asked Questions

What is LL-37?

LL-37 is a 37–amino acid cathelicidin-derived peptide supplied exclusively for laboratory research use.

What is the CAS number for LL-37?

597562-32-8

How should LL-37 be stored?

Store sealed in a dry environment protected from light. For maximum long-term preservation, storage at -20°C is recommended.

Is LL-37 third-party tested?

Yes. Every batch undergoes independent third-party testing prior to release.

Where can I access the COA for LL-37?

COAs are available below the product image in the 3rd Party Testing section on the product page.

Is LL-37 FDA approved?

BioEdge LL-37 is sold strictly as a research compound for in vitro laboratory use. It has not been evaluated or approved by the FDA for any human use in this form. All products sold by BioEdge Research Labs are for laboratory and research purposes only.

Do you ship LL-37 within the USA?

Yes. BioEdge Research Labs is a USA based supplier with same day domestic shipping on orders placed before 3pm Eastern. Free shipping on orders over $150.

Can I get bulk pricing on LL-37?

Yes. Contact BioEdge Research Labs directly for institutional and bulk research pricing.


Published References

1. Steinstraesser L, et al. “Host defense peptide LL-37 modulates proinflammatory responses in keratinocytes and skin wound models.” Peptides. 2016;75:23-31. Link

2. Niyonsaba F, et al. “LL-37 enhances the expression of cytokines by human mast cells and leukocytes.” Journal of Leukocyte Biology. 2005;77(4):451-458. Link

3. Dürr UH, et al. “LL-37, the only human member of the cathelicidin family of antimicrobial peptides.” Archivum Immunologiae et Therapiae Experimentalis. 2010;58(3):203-220. Link


RESEARCH USE ONLY Disclaimer

RESEARCH USE ONLY. LL-37 is sold exclusively for in vitro laboratory and research purposes. This product is not intended for human or animal consumption, clinical use, or therapeutic application. It has not been evaluated by the Food and Drug Administration (FDA) for safety, efficacy, or any medical purpose. Purchase and use of this product confirms the buyer will use it only in qualified research settings, in compliance with all applicable federal, state, and local regulations. BioEdge Research Labs is a chemical supplier, not a compounding pharmacy or clinical facility as defined under 503A of the Federal Food, Drug, and Cosmetic Act. BioEdge Research Labs makes no claims regarding therapeutic, diagnostic, or clinical applications of this compound.

Additional information

Weight

10MG, 5MG

You may also like

,

BPC-157 (10mg)

Original price was: $65.00.Current price is: $59.00.
,

Ipamorelin (10mg)

Original price was: $72.00.Current price is: $65.00.
,

Pinealon (10mg)

Original price was: $54.00.Current price is: $49.00.
,

BPC-157 + TB-500 (5mg/5mg)

Original price was: $89.00.Current price is: $80.00.