-20%
Thymosin Alpha (x4) and LL-37 (x1) - Image 1

Thymosin Alpha (x4) and LL-37 (x1)

Glutathione (x4) + NAD (x2)
BPC-157 (10mg) + BPC-157 500mcg (60 Count)

Original price was: $416.00.Current price is: $333.00.

Thymosin Alpha 1 (10mg)
Thymosin Alpha 1 (10mg)
Original price was: $98.00.Current price is: $88.00.
4
+
LL-37 - 5MG
LL-37 - 5MG
Original price was: $75.00.Current price is: $64.00.
1
Category:
BUY NOW

Description

Thymosin Alpha-1 10mg (×4) + LL-37 5mg (×1) Multi-Unit Supply

This multi-unit research supply contains separate lyophilized preparations of Thymosin Alpha-1, a synthetic thymic peptide, and LL-37, a cationic host-defense peptide derived from the human cathelicidin precursor. These compounds are supplied for laboratory research applications including peptide characterization, immune-related signaling studies, and in vitro assay development involving antimicrobial and regulatory peptide systems.

Product Specifications

Product Format Multi-unit supply (5 individual vials)
Contents Thymosin Alpha-1 10 mg (× 4 vials) + LL-37 5 mg (× 1 vial)
Purity ≥99% (HPLC verified)
Form Lyophilized powder
Appearance White to off-white powder

 

Compound Sequence / Description Molecular Formula Molecular Weight CAS Number
Thymosin Alpha-1 Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH C129H215N33O55 3108.3 g/mol 62304-98-7
LL-37 [LL-37, 37 aa] C205H340N60O55 4493.3 g/mol 172754-62-0

Research Applications

  • In vitro peptide stability and degradation profiling under defined buffer systems
  • Cell-based signaling and immune-pathway modeling workflows
  • Antimicrobial and membrane-interaction assay development
  • LC-MS and HPLC-based identity confirmation and purity verification
  • Structure-activity relationship (SAR) analysis of regulatory and host-defense peptides
  • Multi-peptide assay workflows involving immune and epithelial cell models

Quality Documentation

Certificate of Analysis and HPLC chromatogram are available for each lot.

For Laboratory Research Use Only

This product is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not for diagnostic, therapeutic, or clinical applications.