GLPR3 + Tesamorelin Multi-Unit Supply

Description

GLPR3 + Tesamorelin Multi-Unit Supply

This multi-unit peptide supply contains separate lyophilized vials of GLPR3 and Tesamorelin. Each peptide is provided for laboratory research applications such as receptor binding studies, signaling pathway analysis, and analytical peptide characterization workflows.

---

Product Specifications

Product Format	Multi-unit supply (3 vials)
Contents	GLP R3 10 mg + Tesamorelin 2 × 10 mg
Purity	≥98% (HPLC verified)
Form	Lyophilized powder
Appearance	White to off-white powder

 

Peptide	Sequence	Molecular Formula	Molecular Weight	CAS Number
GLPR3	YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS	C221H342N46O68	4731.33 g/mol	2381089-83-2
Tesamorelin	Tyr-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Arg-Arg-Ala-Ala-Ala-NH₂	C120H203N41O36S	4448 g/mol	197138-46-4

---

Research Applications

• Receptor binding affinity studies involving GLP-family and GHRH receptor targets
• GPCR signaling pathway analysis in controlled in vitro cell line systems
• Peptide identity confirmation using HPLC/UPLC and LC-MS analytical workflows
• Peptide stability and degradation profiling under defined buffer and temperature conditions
• Comparative structure-activity relationship (SAR) studies across incretin and GHRH analog panels

---

Quality Documentation

Certificate of Analysis and HPLC chromatogram available for each lot.

---

For Laboratory Research Use Only

This product is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not for diagnostic, therapeutic, or clinical applications.